Categories
Articles

ABBS 2005,38(02): Anti-HIV I/II activity and molecular cloning of a novel mannose/sialic acid-binding lectin from rhizome of Polygonatum cyrtonema Hua

 


Original Paper

Pdf
file on Synergy

omments

Acta Biochim Biophys
Sin 2006, 38: 70-78

doi:10.1111/j.1745-7270.2006.00140.x

Anti-HIV I/II activity and molecular cloning
of a novel mannose/sialic acid-binding
lectin from rhizome of Polygonatum cyrtonema
Hua

 

Jie An1#, Jin-zhi Liu1#, Chuan-fang Wu1, Jian Li1, Lei Dai1, Els Van Damme2, Jan Balzarini3, Erik De Clercq3, Fang Chen1*, and Jin-ku Bao1*

 

1 2 Department of Molecular Biotechnology, 3 Rega Institute for Medical Research,

 

Received: Accepted: This work was supported by a grant from the National Natural Science
Foundation of # These authors contributed equally to this work

*Corresponding authors:

Jin-Ku Bao: Tel,
86-28-85410672; Fax, 86-28-85417281; E-mail, [email protected]

Fang CHen: Tel,
86-28-85417281; Fax, 86-28-85417281; E-mail, [email protected]

 

Abstract        The anti-human immunodeficiency virus
(HIV) I/II activity of a mannose and sialic acid binding lectin isolated from
rhizomes of Polygonatum cyrtonema Hua was elucidated by comparing its
HIV infection inhibitory activity in MT-4 and CEM cells with that of other
mannose-binding lectins (MBLs). The anti-HIV activity of Polygonatum
cyrtonema
Hua lectin (PCL) was 10- to 100-fold more potent than other
tested MBLs, but without significant cytotoxicity towards MT-4 or CEM cells. To
amplify cDNA of PCL by 3/5-rapid amplification of cDNA ends
(RACE), the 30 amino acids of N-terminal were determined by sequencing and the
degenerate oligonucleotide primers were designed. The full-length cDNA of PCL ­contained
693 bp with an open reading frame encoding a precursor protein of 160 amino
acid residues, consisting of a 28-residue signal peptide, a 22-residue
C-terminal cleavage peptide and a 110-residue mature polypeptide which
contained three tandemly arranged subdomains with an obvious sequence homology
to the monocot MBL. However, only one active mannose-binding site (QDNVY) was
found in subdomain I of PCL, that of subdomain II and III changed to HNNVY and
PDNVY, respectively. There was no intron in PCL, which was in good agreement
with other monocot MBLs. Molecular modeling of PCL indicated that its ­­three-dimensional
structure resembles that of the snowdrop agglutinin. By docking, an active
sialic acid-binding site was found in PCL. The instabilization of translation
initiation region (TIR) in mRNA of PCL benefits its high expression in
rhizomes.

 

Key words        Polygonatum cyrtonema HUA;
mannose-binding lectin; anti-human immunodeficiency virus (HIV) I/II; molecular
cloning; 3/5-rapid amplification of cDNA ends (RACE); sequence
alignment; molecular­ modeling; docking

 

Plant lectins are
reversible carbohydrate-binding proteins­ (or glycoproteins) of non-immuno
origin that agglutinate cells and/or precipitate glycoconjugates. They possess
at least one non-catalytic domain and are usually considered a heterogeneous
group of proteins because of the apparent­ differences in molecular structure,
sugar specificity and biological activities between individual lectins [1,2].
Recent­ advances in the biochemistry, molecular ­cloning and structural­
analysis of the lectins revealed the occurrence of seven families of
structurally and ­evolutionary related proteins which include the legume
lectins, the monocot mannose-binding lectins (MBLs), the chitin-binding lectins
composed of hevein domains, the type 2 ribosome inactivating­ proteins (RIPs
II) and ­relevant lectins, jacalin-related lectins (amaranthin lectin family)
and the cucurbitaceae phloem lectins [3]. Among them, the monocot­ MBLs (a
superfamily of strictly mannose-specific­ lectins) have been found exclusively
in a subgroup of the monocotyledonous plants. All monocot MBLs consist of
subunits with a similar sequence and overall ­three-dimensional­ structure. The
first monocot MBL was reported­ in 1987, when a lectin with an exclusive
specificity­ towards mannose was isolated from snowdrop (Galanthus nivalis)
bulbs [4]. Since then, related lectins have been found in various tissues of
monocot families: Alliaceae, Amaryllidaceae, Araceae, Bromeliaceae, Iridaceae,
Liliaceae and Orchidaceae. Biochemical analysis and molecular ­cloning clearly
indicated that all these lectins belong to a single superfamily of monocot
mannose-binding proteins, which were named according to their origin and ­specificity
[5,6]. At present, the monocot MBLs are still being ­studied intensively because
of their i
nteresting
biological properties, such as potent inhibition towards retroviruses,
which could
possibly be
applied in crop
protection against insects­ and nematodes [3].
Two representative
monocot MBLs, Galanthus nivalis agglutinin (GNA) and Narcissus
pseudonarcissus
agglutinin (NPA), have been previously reported to be
effective inhibitors of the infection of HIV and feline immunodeficiency virus
(FIV), respectively [7,8].

Polygonatum cyrtonema Hua is a
typical representative of the monocot Liliaceae family and is also an important
traditional Chinese herbal medicine. The rhizomes of this plant have been used
as a tonic, which benefits the spleen, lung and kidney, and as a traditional
medicine for hypertension and diabetes without side effects in Chinese medicine
science for about 2000 years. The polysaccharide extracted from Polygonatum
cyrtonema
has an active effect on the immune system of mice [9] and the
mannose/sialic acid-binding protein from the rhizome has ­multi-biological
activities, such as hemagglutination, mitogen and calcium channel block
[10,11]. In addition, anti-tumor studies on Polygonatum cyrtonema lectin
(PCL) indicated that the lectin exhibited a potent suppressive activity on
gastric tumor cell lines SGC and HSC [12].

In this paper, we
describe the anti-HIV-I/II activity of lectin and the molecular cloning of the
lectin gene from rhizome of Polygonatum cyrtonema Hua. More
bioinformatic analysis based on the sequence of PCL is also presented which may
enable us to further understand its mechanism at the molecular level
.

 

 

Materials and methods

 

Polygonatum cyrtonema Hua plant

 

The young rhizomes of Polygonatum
cyrtonema
Hua were collected from

 

Purification of PCL and
mass spectrometry analysis

 

PCL was purified
according to a previous study [13]. Matrix-assisted laser
desorption/ionization-time of flight (MALDI-TOF) mass spectrometry was
performed using a Voyager-RP mass spectrometer (PerSeptive,

 

Antiviral assay for HIV

 

PCL was evaluated for
its inhibitory effect against HIV-I/II-induced cytopathicity in CEM and MT-4
cells,

and
other four monocot MBLs, GNA [14], Lycoris radiata agglutinin
(LRA), Listera ovata
agglutinin (LOA) and Scilla
campanulata
agglutinin (SCA) [15
17], were
tested as controls. The method of the anti-HIV assay has been described
previously [18]. Briefly, CEM and MT-4 cells (4.5
´105 cells/ml) were suspended in fresh culture
medium and infected with HIV-I and HIV-II at 100 CCID50 per milliliter of cell suspension (1 CCID50 being the dose infective for 50% of cell
cultures). Then, 100
ml of the infected
cell suspension was transferred to microplate wells, mixed with 100
ml of the appropriate dilutions of the test lectins
(i.e. final concentrations of 200, 40, 8, 1.6, 0.32, and 0.062
mg/ml respectively) and further incubated at 37 ºC.
After 4
5 d, syncytium
formation was examined microscopically in the infected CEM and MT-4 cell
cultures. Antiviral activity was expressed as EC50, the 50% effective concentration
corresponded to the lectin concentration required to inhibit HIV-induced
syncytium formation by 50% in the ­virus-infected CEM or MT-4 cell cultures.
The 50% cytotoxicity (CC50) corresponded to the lectin concentration required to reduce
the viability of CEM or MT-4 cells by 50%.

 

Analysis of N-terminal
amino acid sequence

 

The N-terminal amino acid
sequence of PCL was determined by automated Edman degradation. The purified PCL
was subjected to 12.5% sodium dodecyl sulfate-polyacrylamide gel
electrophoresis (SDS-PAGE) and electrotransferred to a PVDF membrane
(Millipore,

 

RNA and DNA isolation

 

The total RNA and DNA
were extracted using the RNA and DNA extraction kit (TaKaRa Bio,

 

3/5-RACE
of Polygonatum cyrtonema lectin gene

 

cDNA synthesis was
performed with the 3-RACE kit (TaKaRa Bio). First, RNA was reversely
transcribed with a cDNA synthesis primer and primer 1 (5-TCGGATCCCCSAACTCCCTSTTCACYGGSCA-3)
was designed according to the N-terminal amino acid sequence of PCL. The 3-RACE
was performed essentially according to the manufacturer’s instructions.
Polymerase chain reaction (PCR) was performed under the following conditions:
cDNA was denatured at 94 ºC for 5 min, followed by 30 cycles of amplification
(94 ºC for 30 s, 55 ºC for 30 s and 72 ºC for 2 min) and 7 min at 72 ºC. The
PCR product was purified and cloned into pUC18-T vector (TaKaRa Bio) for
sequencing.

Based on the sequence of
the 3-RACE product, the specific primers 2 (5-GACCACATTGCGGTCTTGCT-3)
and 3 (5-GCCTGAGTCGTACAACACAAA-3) were designed to amplify the
5 end of PCL. According to the manufacturer’s instructions in the
SMART-RACE cDNA amplification kit (Clontech,

 

Generation of Polygonatum
cyrtonema
lectin ­full-length DNA sequence

 

Based on the nucleotide
sequence of the 3/5-RACE products, gene-specific primers 4 (5-GAAGCATGCGCAGCTAGTAGTAGTCCAATC-3)
and 5 (5-AGGGTCGACATAGATAGATAGTAGTGGTG-3) were designed for the
amplification DNA of PCL from genomic DNA. The thermal cycling program was the
same as that utilized for 3/5-RACE.

 

Bioinformatic analysis
of PCL sequence and structure

 

DNA sequence and the
associated molecular information were analyzed by DNA Tools 6.0 (

 

 

Results

 

Antiviral assay for HIV

 

All four
mannose-specific plant lectins (i.e. GNA, LRA, LOA and SCA) were proved highly
effective at inhibiting HIV-I- and HIV-II-induced cytopathicity in MT-4 and CEM
cells. Their EC50 values ranged from 0.43
mg/ml to 9.00 mg/ml (Table 1) without significant cytotoxicity
towards MT-4 and CEM cells, and the CC50 values ranged in 6.50
83.00 mg/ml. PCL
exhibited inhibition on HIV-I at EC50 of 0.08
mg/ml in MT-4 cells and 0.05 mg/ml in CEM cells, and on HIV-II at EC50 of 0.08 mg/ml in MT-4 cells and 0.10 mg/ml in CEM cells. These results mean that the anti-HIV
potency (EC50)
of PCL was 10- to 100-fold higher (more potent) than those of the other four
lectins. The cytotoxicity of PCL against MT-4 and CEM cells was much lower than
its EC50 towards HIV-I/II, and the CC50 value was 73.00
mg/ml and 74.00 mg/ml,
respectively. This was 10-fold less toxic than two mannose-specific plant
lectins in the total four investigated ones, as their CC50 values ranged from 6.50
8.60 mg/ml. The CC50 values of PCL were almost 1000-fold higher
than its EC50 values. Therefore, PCL was at least 10- to
100-fold more inhibitory against HIV-I and HIV-II in MT-4 and CEM cells.

 

Molecular mass and
N-terminal amino acid sequence of PCL

 

Upon SDS-PAGE, purified
PCL gave a single band corresponding to a molecular mass of approximately 12
kDa (data not shown). Similarly, MALDI-TOF mass spectrum showed that the
molecular mass of PCL was 11.92 kDa (Fig. 1).

Using automated Edman
degradation, 30 amino acids at N-terminal were sequenced as follows: VNSLSSPNSLFTGHSLEVGPSYRLIMPGDC.
Therefore, the degenerate primer was synthesized according to the underlined
amino acid sequence.

 

Cloning of PCL
full-length cDNA

 

Based on the primer 1
designed for the amplification of the 3 end of PCL cDNA, a 550-bp
fragment was obtained. Two specific primers (primer 2 and 3), which were
designed according to the 3-RACE fragment, were used for the
amplification of 5-PCL cDNA and a 290-bp fragment was obtained by
nested PCR. Finally, full-length cDNA and its deduced amino acid sequence were
obtained by analysis of cDNA 3 and 5 end sequence. The
full-length cDNA of PCL (Fig. 2) was 693 bp and contained a 480-bp open
reading frame (ORF) encoding a 160-aimino acid protein. Using the gene specific
primers 4 and 5, the full-length DNA and deduced amino acid sequences were
obtained by PCR on genomic DNA, which was extracted from young rhizomes of Polygonatum
cyrtonema
Hua. By comparison, it was completely the same among the
nucleotide sequence and amino acid sequence of PCL from cDNA and genomic DNA.
Comparison of the nucleotide acid sequence and the amino acid sequence of PCL
from cDNA and genomic DNA revealed completely same among them. This result
indicated that there was no intron in PCL, which was in good agreement with
those of other Amaryllidaceae species, such as Galanthus nivalis.
According to the rules of predicting lectin signal peptide [19] and the
cleavage site of C-terminal [20], a 28-amino acid signal peptide (cleavage site
between A28 and V29) and a 22-amino acid C-terminal
cleavage peptide (cleavage site between A138 and V139) were identified from the PCL
full-length cDNA sequence. So the precursor protein of PCL consists of a
28-residue signal peptide, a 22-residue C-terminal cleavage peptide and a
110-residue mature polypeptide with a molecular weight of 11.92 kDa, and a
predicted isoelectric point of 7.0. These results are consistent with the
accurate molecular weight of 11.920451 kDa by MALDI-TOF mass
spectrometry (Fig. 1).

 

Sequence comparison
between various lectins

 

The alignment of the
amino acid sequences encoding the PCL, Orchidaceae lectin, Liliaceae
lectin, Alliaceae lectin and Amaryllidaceae lectin clearly
indicated that PCL belonged to the monocot MBL superfamily. Homolog analysis
showed the identity between PCL and GNA, Cymbidium hybrid agglutinin
(CA), Allium sativum agglutinin (ASA) and SCA was 61%, 59%, 55.1% and
55%, respectively. The three mannose-binding boxes of all the lectins were
strictly conserved and therefore were functional, except the second and third
boxes in PCL (Fig. 3).
The QDNVY in PCL was replaced by HNNVY and PDNVY in the subdomain II and III of
PCL.

 

Molecular modeling and
docking of PCL

 

The amino acid sequence
of PCL exhibits higher identity and homology with the snowdrop lectin, GNA. Whereas
the three-dimensional structure of GNA has been resolved by X-ray diffraction
analysis, its coordinates can be used to model the structure of lectins with
homologous amino acid sequences. To determine if the overall folding of PCL and
the structure of the carbohydrate-binding sites also resembled that of GNA
[21], hydrophobic cluster analysis (HCA) [22,23] and molecular modeling were
carried out using GNA as a model protein. Molecular modeling of PCL was carried
out using the Swiss-Model program (Biozentrum) [24].

In addition to these
sequence similarities, the minor insertions or deletions mainly occurred in
loops. Structure similarities suggested that both proteins had very similar
three-dimensional structures, so the localization of the 12 strands of
b-sheet, occurring along the HCA plot of GNA, were
readily recognized on the HCA plots (Figs. 4 and 5). The three tandem subdomains were connected by loops to
form a 12-strand
b-barrel
containing three
putative mannose-binding sites, which were located in the clefts formed by the
three bundles of
b-sheet. However, the three mannose-binding sites in PCL
had undergone some changes from those found in GNA. Gln57 and Asp59 of the binding site of subdomain II of GNA
were replaced by His58 and Asn

 

Forecast of PCL mRNA
structure and translation ­initiation region analysis

 

The translation
initiation region (TIR) has an important impact on gene expression, and the
secondary structure of this region will influence gene expression directly. Too
high a concentration of GC in TIR will highly stabilize the secondary
structure, thus the transcription unit can not pass smoothly, thus inhibiting
gene expression [27]. For the calculation of RNA
DG and the forecast of secondary structure, refer to http://www.genebee.msu.su/services/rna2_reduced.html
[28]. After analysis, the GC concentration in PCL TIR was 37%, while it was 50%
in PCL cDNA. The
DG in TIR was 3.19 KJ/Mol and no typical stem-loop structure was
formed (Fig. 10). The high instability of TIR in PCL
mRNA can make
the transcription unit pass smoothly and so benefited high expression of
protein production, which accorded with the role of PCL as the predominant
protein in rhizomes of Polygonatum cyrtonema Hua.

 

 

Discussion

 

In this study, we tested
the HIV inhibitory activity of lectin from the rhizomes of Polygonatum
cyrtonema
Hua, in MT-4 and CEM cells and compared this with GNA, LRA, LOA
and SCA, the classic anti-HIV MBLs. All the tested MBLs were found to be active
without significant cytotoxicity. However, PCL exhibited a much lower EC50 value and the most effective anti-HIV activity,
which was 10- to 100-fold more potent than other tested MBLs. Also, the
cytotoxicity was lower than other MBLs from Amaryllidaceae, Liliaceae and
Orchidaceae.

In the monocot MBL
superfamily, GNA was researched early and its anti-HIV activity mechanism was
clearly represented. GNA had high affinity for
a-(1-3)-D-mannose oligomers and the crystal
structure of GNA has been resolved [25]. It was potent inhibitor of the
HIV-induced cytopathicity and directly interfered the virus-cell membrane
fusion process by binding to the high-mannose glycans on gp120, the crucial
envelope glycoprotein of HIV-I during the infection and blocking the binding of
HIV to target cells [29]. A number of studies had clearly shown that the
binding of MBL to HIV was dependent on the high-mannose glycans on gp120, and
gp120 was extensively glycosylated with N-linked complex and high mannose
carbohydrates accounting for about half of the molecular weight [30,31].
Research showed that gp120 of HIV-I contains approximately 50% of the
high-mannose-type oligosaccharides. All 24 N-linked glycosylation sites were
used in gp120, and 11 of them contained hybrid and/or high-mannose structures,
while 13 of the sites contained complex-type oligosaccharides. Furthermore, many of the complex oligosaccharides
were sialylated [32
34]. The
anti-HIV potency (EC50) of PCL was approximately 10-fold higher, while the
cytotoxicity (CC50)
was about 10-fold less toxic than GNA in MT-4 and CEM cells. It might be that
unlike the other MBLs binding mannose only, PCL binds not only to mannose
oligomers but also to sialic acid on gp120 because it is a mannose- and sialic ­acid-binding
lectin [10]. Therefore, PCL could effectively block the infection of HIV toward
MT-4 and CEM cells, then inhibit the syncytia formation by binding more
saccharides on gp120 and exhibit more effective anti-HIV activity.

Using degenerate
primers, which were specifically designed according to the N-terminal sequences
of PCL, and the RACE-PCR technique, the full-length cDNA of PCL was obtained.
PCL closely resembles the classic monocot MBLs with respect to its
molecular structure and amino acid sequence. However, in contrast with most
other lectins in this family, it differs from the above-mentioned lectins
chiefly in its higher affinity for both mannose and sialic acid, and also
differs with respect to its biological activities [10]. Analysis of the primary
structure of PCL revealed the presence of three mannose binding sites (QDNVY)
as other MBLs, but the subdomain II and III had undergone some changes. The Gln58 and Asp60 were replaced by His58 and Asn

 

 

References

 

 1   Goldstein IJ, Hughes RC, Monsigny M, Osawa T,
Sharon N. What should be called a lectin? Nature 1980, 285: 66

 2   Peumans WJ, Van Damme EJ. Lectins as plant
defense proteins. Plant Physiol 1995, 109: 347
352

 3   Van Damme EJ, Peumans WJ, Barre A, Rougé P.
Plant lectins: A composite of several distinct families of structurally and
evolutionary related proteins with diverse biological roles. Crit Rev Plant Sci
1998, 17: 645
662

 4   Van Damme EJ, Allen AK. Isolation and
characterization of a lectin with exclusively specificity toward mannose from
snowdrop (Galanthus nivalis) bulbs. FEBS Lett, 1987, 215: 140
144

 5   Barre A, Van Damme EJ, Peumans WJ, Rougé P.
Structure-function relationship of monocot mannose-binding lectins. Plant
Physiol 1996, 112: 1531
1540

 6   Van Damme EJ, Astoul CH, Barre A, Rougé P,
Peumans WJ. Cloning and characterization of a monocot mannose-binding lectin
from Crocus vernus (family Iridaceae). Eur J Biochem 2000, 267: 5067
5077

 7   Balzarini J, Schols D, Neyts J, Van Damme E,
Peumans W, De Clercq E.
a-(1-3)- and a-(1-6)-D-mannose-specific plant lectins are markedly
inhibitory to human immunodeficiency virus and cytomegalovirus infections in
vitro. Antimicrob Agents Chemother 1991, 35: 410
416

 8   Weiler BE, Schroder HC, Stefanovich V,
Stewart D, Forrest JM, Allen LB, Bowden BJ et al. Sulphoevernan, a
polyanionic polysaccharide, and the narcissus lectin potently inhibit human
immunodeficiency virus infection by binding to viral envelope protein. J Gen
Virol 1990, 71: 1957
1963

 9   Huang TK. Handbook of composition and
pharmacological action of commonly-used traditional Chinese medicine. In: Huang
Tk ed. 10  Bao JK, Zeng ZK. Purification and
characterization of a lectin from Polygonatum cyrtonema Hua. Eur J Cell
Biol 1997, 74: 3

11  Bao JK, Zeng ZK. The effect of Polygonatum
cyrtonema
Hua lectin II on the transmembrane fluid of calcium on mice
aorta. 12  Bao JK, Zeng ZK. Study on molecular stability
and biological activity of Polygonatum cyrtonema Hua lectin II. Sheng Wu
Hua Xue Za Zhi 1996, 12: 747
749

13  Bao JK, Zeng ZK, Zhou H. Purification and
characterization of Polygonatum cyrtonema. Sheng Wu Hua Xue Za Zhi 1996,
12: 165
170

14  Woo BH, Lee JT, Na DH, Lee KC.
Sepharose-unbinding ricin E as a source for ricin A chain immunotoxin. J
Immunol Methods 2001, 249: 91
98

15  Chang LQ, Wu CF, LU HZ, Liu C, Gu Y, Chen F,
Wu QQ, Bao JK. Purification and characterization of agglutinin from bulbs of Lycoris
radiata
(Amarylidaceae). Ying Yong yu Huan Jing Xue Bao 2005, 11(2): 164
167

16  Van Damme EJ, Smeets K, Torrekens S, Van
Leuven F, Peumans WJ. Characterization and molecular cloning of mannose-binding
lectins from the Orchidaceae species Listera ovata, Epipactis
helleborine
and Cymbidium hybrid. Eur J Biochem 1994, 221: 769
777

17  Wright LM, Van Damme EJ, Barre A, Allen AK,
Van Leuven F, Reynolds CD, Rougé P et al. Isolation, characterization,
molecular cloning and molecular modelling of two lectins of different
specificities from bluebell (Scilla campanulata) bulbs. Biochem J 1999,
340: 299
308

18  Balzarini J, Naesens L, Slachmuylders J,
Niphuis H, Rosenberg I, Holy A, Schellekens H et al.
9-(2-Phosphonylmethoxyethyl)adenine (PMEA) effectively inhibits retrovirus
replication in vitro and simian immunodeficiency virus infection in
rhesus monkeys. AIDS 1991, 5: 21
28

19  Von Heijine G. A new method for predicting
signal sequence cleavage sites. Nucleic Acids Res 1986, 14: 4683
4690

20  Van Damme EJ. Molecular cloning and
characterization of multiple isoforms of the snowdrop (Galanthus nivalis
L.) lectin. Planta 1991, 186: 35
43

21  Hester G, Wright CS. The mannose-specific bulb
lectin from Galanthus nivalis (snowdrop) binds mono and dimannosides at
distinct sites. Structure analysis of refined complexes at 2.3 Å and 3.0 Å
resolution. J Mol Biol 1996, 262: 516
531

22  Gaboriaud C, Bissery V, Benchetrit T, Mornon
JP. Hydrophobic cluster analysis: an
efficient new way to compare and analyse amino acid sequences. FEBS Lett 1987,
224: 149
155

23  Lemesle-Varloot L, Henrissat B, Gaboriaud C,
Bissery V, Morgat A, Mornon JP. Hydrophobic cluster analysis: procedures to
derive structural and functional information from 2-D-representation of protein
sequences. Biochimie 1990, 72: 555
574

24  Schwede T, Kopp J, Guex N, Peitsch MC.
SWISS-MODEL: An automated protein homology-modeling server. Nucleic Acids Res
2003, 31: 3381
3385

25  Hester G, Kaku H, Goldstein IJ, Wright CS.
Structure of mannose-specific snowdrop (Galanthus nivalis) lectin is
representative of a new plant lectin family. Nat Struct Biol 1995, 2: 472
479

26  Morris GM, Goodsell DS, Halliday RS, Huey R,
Hart WE, Belew RK, Olson AJ. Automated docking using a Lamarckian genetic
algorithm and empirical binding free energy function. J Comput Chem 1998, 19:
1639
1662

27  Ganoza MC, Kofoid EC, Marliere P. Potential secondary
structure at translation-initiation sites. Nucleic Acids Res 1987, 15: 345
360

28  Brodsky LI, Ivanov VV, Kalaidzidis YL,
Leontovich AM, Nikolaev VK, Feranchuk SI, Drachev VA. GeneBee-NET:
Internet-based server for analyzing biopolymers structure. Biochemistry 1995,
60: 923
928

29  Balzarini J, Hatse S, Vermeire K, Princen K,
Aquaro S, Perno CF, Clercq ED et al. Mannose-specific plant lectins from
the Amaryllidaceae family qualify as efficient microbicides for
prevention of human immunodeficiency virus infection. Antimicrob Agents
Chemother 2004, 48: 3858–3870

30  Ji X, Gewurz H, Spear GT. Mannose binding
lectin (MBL) and HIV. Mol Immunol 2005, 42: 145
152

31  Favero J. Lectins in AIDS research.
Glycobiology 1994, 4: 387
396

32  Leonard CK, Spellman MW, Riddle L, Harris RJ,
Thomas JN, Gregory TJ. Assignment of intrachain disulfide bonds and
characterization of potential glycosylation sites of the type 1 recombinant
human immunodeficiency virus envelope glycoprotein (gp120) expressed in Chinese
hamster ovary cells. J Biol Chem 1990, 265: 10373
10382

33  Balzarini J, Laethem KV, Hatse S, Vermeire K,
Clercq ED, Peumans W, Damme EV et al. Profile of resistance of human
immunodeficiency virus to mannose-specific plant lectins. J virol 2004, 78:
10617–10627

34  Hart ML, Saifuddin M, Uemura K, Bremer EG,
Hooker B, Kawasaki T, Spear GT. High mannose glycans and sialic acid on gp120
regulate binding of mannose-binding lectin (MBL) to HIV type 1. AIDS Res Hum
Retroviruses 2002, 18: 1311–1317